search
GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Welcome to Curious Corner
£0.00
Pug Handbag with crossbody strap embroidered
Pug Handbag with crossbody strap embroidered Pug Handbag with crossbody strap embroidered Pug Handbag with crossbody strap embroidered Pug Handbag with crossbody strap embroidered Pug Handbag with crossbody strap embroidered Pug Handbag with crossbody strap embroidered

Pug Handbag with crossbody strap embroidered

£40.00 inc. tax
Description
Pug faux leather embroidered bag.

Faux leather dark brown bag, crossbody strap, embroidered pug on front pocket, fully lined with one internal zip pocket.

Measures 25 x 25 cm approx.

Handmade in Norfolk.
Shop local.
Details
Product Code: 9Ll9wG
Brand: Curious Corner
weight: 300.0g
Product Condition: New
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i